Skip to Content
Merck
All Photos(1)

Key Documents

HPA029853

Sigma-Aldrich

Anti-CYR61 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CCN1, Anti-GIG1, Anti-IGFBP10, Anti-cysteine-rich, angiogenic inducer, 61

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CYR61(3491)

General description

CYR61 (cysteine-rich angiogenic inducer 61) is an extracellular and heparin-binding protein . It is also known as CCN1 (CCN family member 1) and IGFBP10 (angiogenic factor). It belongs to the CCN group of protein family . It is located on human chromosome 1p22.3. During wound healing, CYR61 is seen in dermal fibroblasts of the granulation tissue.

Immunogen

cysteine-rich, angiogenic inducer, 61 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CYR61 has been used in immunohistochemistry and immunoblot analysis.

Biochem/physiol Actions

CYR61 (cysteine-rich angiogenic inducer 61) plays a protective role in AKI. It also has an antiapoptotic role in hypoxia induced HK-2 (proximal tubule epithelial cell line ) cells. It participates in several mechanisms, including ECM (extracellular matrix) production and fibrosis. It serves as a factor, that induces angiogenesis and chondrogenesis differentiation. In skin fibroblasts, CYR61 triggers a genetic program for wound healing.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76823

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Genome wide gene expression analysis of the posterior capsule in patients with osteoarthritis and knee flexion contracture
Campbell TM, et al.
The Journal of Rheumatology, 41(11), 2232-2239 (2014)
Expression and function of CYR61, an angiogenic factor, in breast cancer cell lines and tumor biopsies
Tsai MS, et al.
Cancer Research, 60(20), 5603-5607 (2000)
The angiogenic factor Cyr61 activates a genetic program for wound healing in human skin fibroblasts
Chen CC, et al.
The Journal of Biological Chemistry, 276(50), 47329-47337 (2001)
7,8-DHF Treatment Induces Cyr61 Expression to Suppress Hypoxia Induced ER Stress in HK-2 Cells
Ma R, et al.
BioMed Research International (2016)
Artur Wnorowski et al.
Scientific reports, 12(1), 3618-3618 (2022-03-09)
Metabolic reprogramming contributes to oncogenesis, tumor growth, and treatment resistance in pancreatic ductal adenocarcinoma (PDAC). Here we report the effects of (R,S')-4'-methoxy-1-naphthylfenoterol (MNF), a GPR55 antagonist and biased β2-adrenergic receptor (β2-AR) agonist on cellular signaling implicated in proliferation and metabolism

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service