Skip to Content
Merck
All Photos(3)

Key Documents

AV38234

Sigma-Aldrich

Anti-SOX4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-EVI16, Anti-SRY (sex determining region Y)-box 4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

47 kDa

species reactivity

rabbit, rat, guinea pig, bovine, mouse, human, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SOX4(6659)

General description

SRγ (sex determining region γ) (SOX) are HMG box containing transcription factors that bind to the minor groove of DNA. Sox proteins family members regulate a variety of aspects of development. SRγ (sex determining region γ)-box 4 (SOX4, EVI16, SRγ) is required for differentiation and proliferation in many tissues, including various cancers. Sox4 acts in part by stabilizing β-catenin. Sox4 is required for lymphocyte development. It is an early factor in B-cell differentiation.
SRY (sex determining region Y) (SOX) are high-mobility-group (HMG) box containing transcription factors, that binds to the minor groove of DNA. SRY box 4 (SOX4) is a member of the SOX family of transcription factors. It is expressed majorly in normal and neoplastic gut tissues. SOX4 gene is located on human chromosome 6p22.3.

Specificity

Anti-SOX4 polyclonal antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken SRγ (sex determining region γ)-box 4 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human SOX4

Application

Anti-SOX4 polyclonal antibody is used to tag SRγ (sex determining region γ)-box 4 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of SRγ (sex determining region γ)-box 4 in cell differentiation and proliferation, such as B-cell differentitation.

Biochem/physiol Actions

SRY box 4 (SOX4) is required for differentiation and proliferation in many tissues, including various cancers. It stabilizes β-catenin. Sox4 is essential for lymphocyte development. It acts as an early factor in B-cell differentiation. SOX4 is involved in the regulation of embryonic development and the determination of cell fate. It acts as a transcriptional regulator after forming syndecan binding protein (syntenin), a protein complex. SOX4 modulates the apoptosis pathway, which leads to cell death and tumorigenesis. It regulates downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development.

Sequence

Synthetic peptide located within the following region: STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sox-4 messenger RNA is expressed in the embryonic growth plate and regulated via the parathyroid hormone/parathyroid hormone-related protein receptor in osteoblast-like cells
Reppe S, et al.
Journal of Bone and Mineral Research, 15(12), 2402-2412 (2000)
Sox17 and Sox4 differentially regulate beta-catenin/T-cell factor activity and proliferation of colon carcinoma cells
Sinner D, et al.
Molecular and Cellular Biology, 27(22), 7802-7815 (2007)
Sox4 is required for the survival of pro-B cells
Sun B, et al.
Journal of Immunology, 190(5), 2080-2089 (2013)
SOX4 inhibits GBM cell growth and induces G0/G1 cell cycle arrest through Akt-p53 axis
Zhang J, et al.
BMC Neurology, 14(1), 207-207 (2014)
Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output
Beekman JM, et al.
Oncogene, 31(21), 2668-2679 (2012)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service