SAB5702029

Anti-COX IV Antibody, clone 3P8J2, Rabbit Monoclonal

• Synonym(s): COX IV-1, COX4, COX4-1, COXIV, COXIV-1
• UNSPSC Code: 12352203
• NACRES: NA.46

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 3P8J2, monoclonal
• form: liquid
• mol wt: 17 kDa
• species reactivity: rat, rat, human
• concentration: 0.25 mg/mL
• technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEW
• UniProt accession no.: P13073
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... COX4I1(1327)

Description

General description

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. Pseudogenes related to this gene are located on chromosomes 13 and 14. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human COX IV (P13073).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1