SAB1403056

Monoclonal Anti-FLOT1 antibody produced in mouse

clone 4A1, ascites fluid

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 4A1, monoclonal
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgMκ
• NCBI accession no.: NM_005803
• UniProt accession no.: O75955
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... FLOT1(10211)

Description

General description

Flotillin 1 (FLOT1) is an integral membrane protein and a component of lipid rafts. This estrogen responsive gene is localized on human chromosome 6p21.33.

Immunogen

FLOT1 (NP_005794.1, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI

Biochem/physiol Actions

Flotillin 1 (FLOT1) has a role in endocytosis. It also functions in growth factor signaling and activates mitogen-activated protein kinase signaling. The protein has been associated with tumor progression and is expressed in many cancers.

Physical form

Clear solution

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 13 - Non Combustible Solids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable