Synthetic peptide directed towards the middle region of human CXCL3
Application
Anti-CXCL3 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
CXCL3 is a chemokine that binds to CXCR1 and CXCR2 receptors and stimulates p38 and ERK1/2-dependent migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL3 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer formation.
Target description
CXCL3 is a chemokine that affects migration and adhesion of monocytes. CXCR2 is its known receptor.
Sequence
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of immunology (Baltimore, Md. : 1950), 191(5), 2731-2741 (2013-08-02)
Structural cell migration plays a central role in the pathophysiology of several diseases, including asthma. Previously, we established that IL-17-induced (CXCL1, CXCL2, and CXCL3) production promoted airway smooth muscle cell (ASMC) migration, and consequently we sought to investigate the molecular
Frontiers in neuroscience, 12, 1016-1016 (2019-01-29)
Fibroblasts (Fbs) effectively promote Schwann cells (SCs) migration, proliferation, and neurite regeneration. Whether Fbs express different motor and sensory phenotypes that regulate the cell behavior and peripheral nerve function has not been elucidated. The present study utilized the whole rat
It is well accepted that tumor microenvironment is essential for tumor cells survival, cancer progression and metastasis. However, the mechanisms by which tumor cells interact with their surrounding at early stages of cancer development are largely unidentified. The aim of
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.