Skip to Content
Merck
All Photos(6)

Key Documents

WH0000468M1

Sigma-Aldrich

Monoclonal Anti-ATF4 antibody produced in mouse

clone 2B3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

ATF4 Antibody - Monoclonal Anti-ATF4 antibody produced in mouse, Atf4 Antibody, Anti-CREB2, Anti-TAXREB67, Anti-TXREB, Anti-activating transcription factor 4 (tax-responsive enhancer element B67)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2B3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATF4(468)

General description

Activating transcription factor 4 (ATF4), is a stress-induced transcription factor, encoded by the gene mapped to human chromosome 22q13.1. ATF4 is a member of ATF/CREB (cyclic AMP response element binding protein) family of basic region-leucine zipper (bZip) transcription factors.
This gene encodes a transcription factor that was originally identified as a widely expressed mammalian DNA binding protein that could bind a tax-responsive enhancer element in the LTR of HTLV-1. The encoded protein was also isolated and characterized as the cAMP-response element binding protein 2 (CREB-2). The protein encoded by this gene belongs to a family of DNA-binding proteins that includes the AP-1 family of transcription factors, cAMP-response element binding proteins (CREBs) and CREB-like proteins. These transcription factors share a leucine zipper region that is involved in protein-protein interactions, located C-terminal to a stretch of basic amino acids that functions as a DNA binding domain. Two alternative transcripts encoding the same protein have been described. Two pseudogenes are located on the X chromsome at q28 in a region containing a large inverted duplication. (provided by RefSeq)

Immunogen

ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA

Application

Monoclonal Anti-ATF4 antibody produced in mouse has been used in immunocytochemistry and western blotting.

Biochem/physiol Actions

Activating transcription factor 4 (ATF4) induces cAMP-dependent renal cyst formation. It is implicated in the regulation of genes involved in various cellular processes such as oxidative stress, amino acid synthesis, differentiation, metastasis and angiogenesis. Elevated expression of ATF4 has been observed in cancer patients.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ultrastructural features of aberrant glial cells isolated from the spinal cord of paralytic rats expressing the amyotrophic lateral sclerosis-linked SOD1G93A mutation
Jimenez-Riani, M, et al.
Cell and Tissue Research, 370(3), 391-401 (2017)
Surviving stress: modulation of ATF4-mediated stress responses in normal and malignant cells
Wortel LMN, et al.
Trends in Endocrinology and Metabolism, 28(11), 794-806 (2017)
The centrosomal protein nephrocystin-6 is mutated in Joubert syndrome and activates transcription factor ATF4
Sayer JA, et al.
Nature Genetics, 38(6), 674-681 (2006)
DISC1 variants 37W and 607F disrupt its nuclear targeting and regulatory role in ATF4-mediated transcription
Malavasi ELV, et al.
Human Molecular Genetics, 21(12), 2779-2792 (2012)
Disrupted autophagy after spinal cord injury is associated with ER stress and neuronal cell death
Liu S, et al.
Cell Death & Disease, 6(1), e1582-e1582 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service