Skip to Content
Merck
All Photos(2)

Key Documents

SAB1404094

Sigma-Aldrich

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2A4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

MUC5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2A4, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MUC5AC(4586)

General description

The MUC5AC (mucin 5AC, oligomeric mucus/gel-forming) gene is mapped to human chromosome 11p15.5. Muc5ac is a gel-forming mucin of 40MDa, secreted by the goblet cells of the conjunctiva. Muc5ac is localized to the intermediate aqueous layer of tear film and predominant mucin in the respiratory tract. Muc5ac protein consists of cysteine-rich domains that flanks the central glycosylated tandem repeat domain.

Immunogen

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Application

Muc5ac (mucin 5AC, oligomeric mucus/gel-forming) provides hydration and lubrication effect for epithelial cells that make up cornea and conjunctiva. Parasympathetic and sympathetic nervous system (particularly, parasympathetic neurotransmitters acetylcholine and vasoactive intestinal peptide) controls the Muc5ac secretion. A number pathogens and cytokines can also stimulate Muc5ac secretion in the airway. MUC5AC gene expression is associated with a some pathological conditions such as allergen-induced airway hyperresponsiveness,airway mucus plugging, and mucous metaplasia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Genomic organization of the 3′ -region of the human MUC5AC mucin gene:additional evidence for a common ancestral gene for the 11p15.5 mucin gene family.
Buisine M P, et al.
The Biochemical Journal, 332(3), 729-738 (1998)
Effect of epithelium ATP release on cyclic pressure-induced airway mucus secretion.
Jin T, et al.
Bioscience Reports, 34(1), e00088-e00088 (2014)
Impact of Cigarette Smoking on Tear Function and Correlation between Conjunctival Goblet Cells and Tear MUC5AC Concentration in Office Workers.
Yuichi U, et al.
Scientific Reports, 6, 27699-27699 (2016)
Interleukin-33 induces mucin gene expression and goblet cell hyperplasia in human nasal epithelial cells.
Hajime I, et al.
Cytokine, 90, 60-65 (2017)
Abnormalities in MUC5AC and MUC5B Protein in Airway Mucus in Asthma.
Marrah E L S, et al.
American Journal of Respiratory and Critical Care Medicine, 194(10), 1296-1299 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service