Skip to Content
Merck
All Photos(7)

Documents

HPA014711

Sigma-Aldrich

Anti-EMP2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-EMP-2, Anti-Epithelial membrane protein 2, Anti-Protein XMP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EMP2(2013)

General description

EMP2 (epithelial membrane protein 2) belongs to the family of four-transmembrane domains proteins called growth arrest-specific gene 3 (GAS-3)/peripheral myelin protein 22 (PMP22). It is a transmembrane protein, which spans the membrane four times. It is predominantly expressed in secretory endometrium, alveolar epithelium in lungs, and in eye in the retinal pigmented epithelium. This protein has three predicted N-linked glycosylation sites, two exoplasmic domains, and a short cytolsolic tail. It is a tumor suppressor gene for certain cancers such as, B-cell lymphoma.

Immunogen

Epithelial membrane protein 2 recombinant protein epitope signature tag (PrEST)

Sequence
DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

EMP2 (epithelial membrane protein 2) is involved in blastocyst implantation, where it controls the surface expression and localization of integrin αvβ3. It is up-regulated in endometrioid ovarian tumors, which is associated with poor prognosis and survival. It is involved in controlling the correct trafficking of glycolipids and multiple proteins from post-Golgi endosomes to plasma membrane. It also regulates the proper trafficking of specific molecules to glycolipids-enriched lipid raft microdomains (GEMs). It interacts with and activates focal adhesion kinase (FAK) and the FAK/Src complex, which in turn facilitates collagen gel contraction. This gene is also down-regulated in nasopharyngeal carcinoma (NPC), especially in high grade cases. In NPC, it might be involved in increases tumor aggressiveness, and poor prognosis. It is highly up-regulated in triple negative breast cancer and invasive breast cancer. It might have potential as a therapeutic target for the same.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73193

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Viola K Weinheimer et al.
The Journal of infectious diseases, 206(11), 1685-1694 (2012-07-26)
Highly pathogenic avian H5N1 influenza viruses preferentially infect alveolar type II pneumocytes in human lung. However, it is unknown whether this cellular tropism contributes to high viral virulence because the primary target cells of other influenza viruses have not been
Hussain Gadelkarim Ahmed et al.
Asian Pacific journal of cancer prevention : APJCP, 16(2), 653-656 (2015-02-17)
Nasopharyngeal carcinoma (NPC) is an aggressive disease and tends to involve surrounding tissues, and biomarkers for better management are yet to be identified. One hundred and fifty tissue samples with NPC diagnosis were were investigated using pan cytokeratin (CK) and
Maoyong Fu et al.
Molecular cancer therapeutics, 13(4), 902-915 (2014-01-23)
Despite significant advances in biology and medicine, the incidence and mortality due to breast cancer worldwide is still unacceptably high. Thus, there is an urgent need to discover new molecular targets. In this article, we show evidence for a novel
Yi-Wen Wang et al.
The American journal of pathology, 183(3), 709-719 (2013-07-11)
Upper urinary tract urothelial carcinoma is a relatively uncommon disease and is diagnosed more frequently at advanced stages. The prognosis of these patients mainly has been related to tumor stage and grade. As a result, the definition of prognostic indicators
Shawn A Morales et al.
Investigative ophthalmology & visual science, 50(1), 462-469 (2008-05-13)
Proliferative vitreoretinopathy (PVR) occurs in approximately 10% of patients after retinal detachment. PVR results from a multiphase process that leads to an aberrant wound-healing strategy with contractile cellular forces and tractional retinal detachment (TRD). Epithelial membrane protein (EMP) 2 controls

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service