Skip to Content
Merck
All Photos(2)

Key Documents

WH0011074M3

Sigma-Aldrich

Monoclonal Anti-TRIM31 antibody produced in mouse

clone 2G11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-C6orf13, Anti-HCG1, Anti-HCGI, Anti-RNF, Anti-tripartite motif-containing 31

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2G11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunofluorescence: suitable
indirect ELISA: suitable

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TRIM31(11074)

Related Categories

General description

TRIM31 (tripartite motif-containing 31) belongs to TRIM (tripartite motif-containing protein) family. It is particularly expressed in the gastrointestinal tract. TRIM31 contains carboxy-terminal PRY and SPRY (spla kinase and ryanodine receptor) domains. It is usually located in the cytoplasm, but a fraction of TRIM31 is present in the mitochondria. TRIM31 is located on human chromosome 6p22.1.

Immunogen

TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE

Biochem/physiol Actions

Overexpression of TRIM31 (tripartite motif-containing 31) suppresses anchorage-independent cell growth generated by the active form of c-Src. It is expected to play a major role in gastrointestinal tissue-specific regulation of cell proliferation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The ubiquitin E3 ligase TRIM31 promotes aggregation and activation of the signaling adaptor MAVS through Lys63-linked polyubiquitination
Bingyu Liu
Nature Immunology, 18.2, 214-224 (2017)
TRIM31 interacts with p52 Shc and inhibits Src-induced anchorage-independent growth
Masashi W
Biochemical and Biophysical Research Communications, 422-427 (2009)
Prostate Cancer Genetics: Variation by Race, Ethnicity, and Geography
Timothy R
Seminars in Reproductive Medicine, 27(1) (2017)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service