HPA043228

Anti-ACSS1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-ACAS2L, Anti-AceCS2L, Anti-MGC33843, Anti-acyl-CoA synthetase short-chain family member 1, Anti-dJ568C11.3
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA043228
• NACRES: NA.43

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• immunogen sequence: AQPGSYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVRITYRELLETT
• UniProt accession no.: Q9NUB1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACSS1(84532)

Description

General description

Acetyl coenzyme A (CoA) synthetase 1 (ACSS1) is an enzyme which is also termed as Acecs2. It is present in the mitochondria. The ACSS1 gene is located on human chromosome 20p11.21.

Immunogen

acyl-CoA synthetase short-chain family member 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-ACSS1 antibody has been used to estimate the acetate metabolism under metabolic stress.

Biochem/physiol Actions

Acetyl coenzyme A (CoA) synthetase 1 (ACSS1) participates in the oxidation of acetate. It converts acetate to acetyl-CoA in an ATP-dependent reaction. ACSS1 promotes aggressive tumor growth.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST83150

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable