Skip to Content
Merck
All Photos(10)

Key Documents

HPA018537

Sigma-Aldrich

Anti-HOOK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-Protein Hook homolog 1, Anti-h-hook1, Anti-hHK1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
NOK 4,250.00

NOK 4,250.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
NOK 4,250.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

NOK 4,250.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:2500-1:5000

immunogen sequence

KRALEELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHC

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOOK1(51361)

General description

The gene protein Hook homolog-1 (HOOK1) is mapped to human chromosome 1p32.1. It belongs to HOOK family of proteins. HOOK1 transcript is highly expressed in testis. The protein localizes to discrete punctate subcellular structures.

Immunogen

Protein Hook homolog 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-HOOK1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Protein Hook homolog-1 (HOOK1) has been shown to associate with microtubules. HOOK1 is important for cellular trafficking. It is involved in sorting of clathrin independent cargo proteins toward recycling in microtubule-dependent manner.[1] HOOK1 in complex with FTS (Fused Toes) and FHIP (FTS and Hook Interacting Protein) interacts with components of the homotypic vesicular protein sorting (HOPS) complex. This interaction is important to promote vesicle trafficking. In the azh (abnormal spermatozoon head shape) mutant mouse, loss of HOOK1 function results in abnormal shape of sperm head and disturbs linking of the flagellum to the sperm head.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74487

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jun-Chao Xie et al.
American journal of translational research, 10(1), 150-163 (2018-02-10)
Hypoxia promotes the accumulation of amyloid-β (Aβ), which is related to the pathogenesis of Alzheimer's disease (AD). CD147 is considered as an additional subunit of γ-secretase regulated by hypoxia, and has been identified in exosomes. Aβ is also found in
Irene Mendoza-Lujambio et al.
Human molecular genetics, 11(14), 1647-1658 (2002-06-21)
In mice carrying the autosomal recessive mutation 'abnormal spermatozoon head shape' (azh) all spermatozoa display a highly abnormal head morphology that differs drastically from the compact and hook-shaped head of the normal murine sperm. Moreover, the azh mutation causes tail
Lai Xu et al.
Molecular biology of the cell, 19(12), 5059-5071 (2008-09-19)
Fused Toes (FTS) is a member of a small group of inactive variant E2 ubiquitin-conjugating enzyme domain-containing proteins of unknown function. Through proteomic analysis of FTS complexes purified from human embryonic kidney 293T cells, we identified a new multiprotein complex
J H Walenta et al.
The Journal of cell biology, 152(5), 923-934 (2001-03-10)
Microtubules are central to the spatial organization of diverse membrane-trafficking systems. Here, we report that Hook proteins constitute a novel family of cytosolic coiled coil proteins that bind to organelles and to microtubules. The conserved NH(2)-terminal domains of Hook proteins
Lymarie Maldonado-Báez et al.
The Journal of cell biology, 201(2), 233-247 (2013-04-17)
Many plasma membrane (PM) proteins enter cells nonselectively through clathrin-independent endocytosis (CIE). Here, we present evidence that cytoplasmic sequences in three CIE cargo proteins-CD44, CD98, and CD147-were responsible for the rapid sorting of these proteins into endosomal tubules away from

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service