ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. ACCN1 gene may modulate the aggressiveness of neuroblastoma tumors. Rabbit Anti-ACCN1 antibody recognizes canine, bovine, human, rat, and mouse ACCN1.
Immunogen
Synthetic peptide directed towards the C terminal region of human ACCN1
Application
Rabbit Anti-ACCN1 antibody is suitable for western blot applications at a concentration of 2 μg/ml.
Biochem/physiol Actions
ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
Sequence
Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The human 1p36 region is deleted in many different types of tumors, and so it probably harbors one or more tumor suppressor genes. In a Belgian neuroblastoma patient, a constitutional balanced translocation t(1;17)(p36.2;q11.2) may have led to the development of
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.