Skip to Content
Merck
All Photos(5)

Key Documents

HPA015475

Sigma-Aldrich

Anti-NOX4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-KOX-1, Anti-Kidney superoxide-producing NADPH oxidase, Anti-NADPH oxidase 4, Anti-Renal NAD(P)H-oxidase

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYI

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NOX4(50507)

General description

NOX4 (NADPH oxidase 4) belongs to the NOX family of proteins, and is the major member of this family to be expressed in human brain pericytes. It is also highly expressed in kidney, endothelial and vascular smooth muscle cells. It resides in mitochondrial membrane and endoplasmic reticulum (ER). It is a transmembrane protein, which contains two heme groups, and its C-terminal contains flavin adenine dinucleotide and NADPH-binding domains.

Immunogen

NADPH oxidase 4 recombinant protein epitope signature tag (PrEST)

Application

Anti-NOX4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

NOX4 (NADPH oxidase 4) is involved in the growth and proliferation of human brain pericytes. It is activated by hypoxia and angiotensin II, and is responsible for the production of reactive oxygen species (ROS) in brain pericyte membranes, in an NAD(P)H-dependent manner. It might be one of the factors involved in the pathogenesis of cardiovascular disorders. It is involved in pathogen elimination, where NOX-4-produced ROS, by phagocytes, facilitates autophagy. This also determines the survival of vascular and tumor cells. In hypoxic conditions, this protein facilitates erythropoietin secretion in kidney. It has cardioprotective role during energy crisis, and this is achieved by the activation of Nox4/PERK/eIF-2α/ATF4 signaling cascade. NOX4-produced ROS also regulates the activation of redox-sensitive pathways, which in turn determines the replication of Influenza virus in the epithelial cells of lungs.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73209

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sebastiano Sciarretta et al.
Circulation research, 113(11), 1253-1264 (2013-10-02)
Autophagy is an essential survival mechanism during energy stress in the heart. Oxidative stress is activated by energy stress, but its role in mediating autophagy is poorly understood. NADPH oxidase (Nox) 4 is an enzyme that generates reactive oxygen species
Nicole M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(9), 1145-1152 (2014-02-13)
Uterine fibroids are the most common benign tumor in women. The goal of this study was to investigate whether nicotinamide adenine dinucleotide phosphate oxidase (NOX), a major source of superoxide and subsequent oxidative stress, was differentially regulated in myometrium versus
Donatella Amatore et al.
Cellular microbiology, 17(1), 131-145 (2014-08-27)
An overproduction of reactive oxygen species (ROS) mediated by NADPH oxidase 2 (NOX2) has been related to airway inflammation typical of influenza infection. Virus-induced oxidative stress may also control viral replication, but the mechanisms underlying ROS production, as well as
N M Fletcher et al.
Reproductive sciences (Thousand Oaks, Calif.), 21(8), 1050-1059 (2014-02-12)
We have previously reported that superoxide (O2•-) contributes to the development of postoperative adhesions. In this study, we determined whether O2•- generating nicotinamide adenine dinucleotide phosphate oxidase (NOX) is differentially expressed in normal peritoneal and adhesion fibroblasts and tissues. The
Sebastiano Sciarretta et al.
Clinical science (London, England : 1979), 128(7), 387-403 (2014-12-18)
In the past several years, it has been demonstrated that the reactive oxygen species (ROS) may act as intracellular signalling molecules to activate or inhibit specific signalling pathways and regulate physiological cellular functions. It is now well-established that ROS regulate

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service