Skip to Content
Merck
All Photos(1)

Key Documents

AV50251

Sigma-Aldrich

Anti-COX3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Cytochrome c oxidase III

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

29 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MTCO3(4514)

General description

Mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) is encoded by the mitochondrial DNA and localizes to the inner mitochondrial membrane. COX3 is generally mentioned as COXIII.

Immunogen

Synthetic peptide directed towards the C terminal region of human COX3

Application

Anti-COX3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Cytochrome oxidases make up the terminal complex of the electron transport chain in the mitochondria. Deletions in mitochondrially encoded cytochrome c oxidase III (MT-CO3; COX3) gene are associated with rhabdomyolysis. Mutation in COX3 is linked to maternally inherited diabetes and deafness associated with nephropathy. COX3 mutations have been observed in asthenozoospermic infertile men, patients with MELAS (mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes) and Leber hereditary optic neuropathy. Hepatitis B virus X protein interacts with COX3 and the intercation might be crucial for hepatocarcinoma tumorigenesis.

Sequence

Synthetic peptide located within the following region: FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Siwar Baklouti-Gargouri et al.
Journal of assisted reproduction and genetics, 31(5), 595-600 (2014-02-20)
Infertility affects 10-15 % of the population, of which, approximately 40 % is due to male etiology consisting primarily of low sperm count (oligozoospermia) and/or abnormal sperm motility (asthenozoospermia). It has been demonstrated that mtDNA base substitutions can greatly influence
Structure and function of cytochrome c oxidase.
R A Capaldi
Annual review of biochemistry, 59, 569-596 (1990-01-01)
D R Johns et al.
Biochemical and biophysical research communications, 196(2), 810-815 (1993-10-29)
New mitochondrial DNA mutations were discovered in the cytochrome c oxidase subunit III gene in 8 independent Leber hereditary optic neuropathy probands. A mutation at nucleotide position 9438 was found in 5 probands, changed highly conserved glycine-78 to serine (G78S)
G Manfredi et al.
Neuromuscular disorders : NMD, 5(5), 391-398 (1995-09-01)
We report a patient with mitochondrial encephalomyopathy, lactic acidosis and stroke-like episodes (MELAS) who harbored a novel missense mutation at mtDNA position 9957 in the gene specifying subunit III of cytochrome c oxidase (COX III). This T-->C transition converted Phe-251
Mouna Tabebi et al.
Biochemical and biophysical research communications, 459(3), 353-360 (2015-02-24)
Mitochondrial diabetes (MD) is a heterogeneous disorder characterized by a chronic hyperglycemia, maternal transmission and its association with a bilateral hearing impairment. Several studies reported mutations in mitochondrial genes as potentially pathogenic for diabetes, since mitochondrial oxidative phosphorylation plays an

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service