Skip to Content
Merck
All Photos(4)

Documents

WH0023265M1

Sigma-Aldrich

Monoclonal Anti-EXOC7 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-253p, Anti-EX070, Anti-EXO70, Anti-EXOC1, Anti-Exo70p, Anti-YJL085W, Anti-exocyst complex component 7

Sign Into View Organizational & Contract Pricing
All Photos(4)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D4, monoclonal

form

buffered aqueous solution

species reactivity

rat, human, mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

NM_001013839

UniProt accession no.

Q9UPT5

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... EXOC7(23265)

General description

EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al., 2006 [PubMed 17086175]).[supplied by OMIM

Immunogen

EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA

Biochem/physiol Actions

EXOC7 (Exocyst complex component 7) is mainly involved in the exocytosis, a membrane trafficking process of intracellular protein elements such as hormones and neurotransmitters, membrane proteins and lipids to specific domains of the plasma membrane. Exocytosis plays a vital role in the cellular growth, development and cell polarity establishment. During exocytosis, it directly connects with the plasma membrane through its direct interaction with phosphatidylinositol 4,5-bisphosphate (PI(4,5)P(2)). It has also been reported that the interaction between EXOC7 and PI(4,5)P(2) is highly essential for the docking and fusion of post-Golgi secretory vesicles.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jianglan Liu et al.
Molecular biology of the cell, 18(11), 4483-4492 (2007-09-01)
The exocyst is an evolutionarily conserved octameric protein complex that tethers post-Golgi secretory vesicles at the plasma membrane for exocytosis. To elucidate the mechanism of vesicle tethering, it is important to understand how the exocyst physically associates with the plasma
Shu-Chan Hsu et al.
International review of cytology, 233, 243-265 (2004-03-24)
Exocytosis is an essential membrane traffic event mediating the secretion of intracellular protein contents such as hormones and neurotransmitters as well as the incorporation of membrane proteins and lipids to specific domains of the plasma membrane. As a fundamental cell

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service