Skip to Content
Merck
All Photos(4)

Key Documents

SAB2101093

Sigma-Aldrich

Anti-HSP90AA1 (ab2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FLJ31884, Anti-HSP86, Anti-HSP90A, Anti-HSP90N, Anti-Heat shock protein 90kDa α (cytosolic), class A member 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
RM 1,922.00

RM 1,922.00


Estimated to ship on14 May 2025



Select a Size

Change View
100 μL
RM 1,922.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

RM 1,922.00


Estimated to ship on14 May 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

98 kDa

species reactivity

mouse, rabbit, human, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... HSP90AA1(3320)

Immunogen

Synthetic peptide directed towards the N terminal region of human HSP90AA1

Biochem/physiol Actions

HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219).

Sequence

Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hui-Yu Chen et al.
Veterinary parasitology, 205(3-4), 540-550 (2014-10-02)
Anisakid nematodes are distributed worldwide in a wide variety of marine fishes and they are known to cause the zoonotic disease, anisakiasis. The temperature control is commonly applied for prevention and control of anisakiasis. To analyze the cellular response to
Balázs Rada et al.
Inflammation research : official journal of the European Histamine Research Society ... [et al.], 63(10), 821-830 (2014-07-23)
We studied the involvement of calcium and calcium-activated NADPH oxidases in NLRP3 inflammasome activation and IL-1β release to better understand inflammasome signaling in macrophages. Human volunteer blood donors were recruited to isolate monocytes to differentiate them into macrophages. Wild-type or
Xin Zhao et al.
Naunyn-Schmiedeberg's archives of pharmacology, 387(11), 1079-1089 (2014-08-12)
Arsenic trioxide (As2O3) is used to treat acute promyelocytic leukemia. However, the cardiotoxicity of long QT syndrome restricts its clinical application. Previous studies showed that As2O3 can damage the human ether-a-go-go-related gene (hERG) current via disturbing its trafficking to cellular

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service