SAB1409650

Monoclonal Anti-LHX5 antibody produced in mouse

clone 2B4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC129689
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2B4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.74 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_022363
• UniProt accession no.: Q9H2C1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... LHX5(64211)

Description

General description

This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice. (provided by RefSeq)

Immunogen

LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable