Skip to Content
Merck
All Photos(3)

Key Documents

HPA011209

Sigma-Aldrich

Anti-FGF4 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FGF-4, Anti-Fibroblast growth factor 4 precursor, Anti-HBGF-4, Anti-HST, Anti-HST-1, Anti-Heparin secretory-transforming protein, Anti-Transforming protein KS3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FGF4(2249)

General description

FGF4 (fibroblast growth factor 4) is a part of FGF family of secreted signaling proteins. FGF family consists of 22 heparin-binding polypeptides. FGF4 conforms in to the β-trefoil fold like other FGF members, and consists of a signal peptide. It was first identified in the screening of Kaposi′s sarcoma and human stomach cancers. This protein is made of 206 amino acids, and contains an N-glycosylation site. This gene is expressed during gastrula and early somite stage embryos, in proximity to the posterior endoderm. In the gut endoderm, it shows an anterior-posterior expression pattern. In adult humans, it is expressed in nervous system, intestines and testis. It is located on human chromosome 11q13.

Immunogen

Fibroblast growth factor 4 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

FGF4 (fibroblast growth factor 4) plays an important role in embryogenesis, and is involved in the patterning and survival of embryo. It is responsible for the activation of IIIc splice forms of FGFR1 to 3 by binding to them. Its expression in the initial stages is essential for the successful formation of induced pluripotent stem cells (iPSCs). This is achieved by the interaction of Artd1 (ADP-ribosyltransferase Diphtheria Toxin-like 1) and Sox2 (SRY (sex determining region Y)-box 2), which regulate reprogramming of cells. FGF4 regulates the development of stromal layers in both normal conditions and in acute myeloid leukemia. This gene is involved in spermatogenesis, and is up-regulated in testicular cancers. It has a protective action against adriamycin-induced testicular toxicity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71534

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Toshiaki Yoshimoto et al.
Anticancer research, 38(1), 501-507 (2017-12-27)
We report the outcomes of sorafenib therapy for advanced hepatocellular carcinoma (HCC) in our Department. Thirty-eight patients with unresectable HCC who were administrated sorafenib from 2009 to 2015 were investigated retrospectively. The 1-year overall survival rate was 59.3%. The macroscopic
Boriana M Zaharieva et al.
The Journal of pathology, 201(4), 603-608 (2003-12-04)
Gene amplification is a common mechanism for oncogene overexpression. High-level amplifications at 11q13 have been repeatedly found in bladder cancer by comparative genomic hybridization (CGH) and other techniques. Putative candidate oncogenes located in this region are CCND1 (PRAD1, bcl-1), EMS1
Fabienne A Weber et al.
Stem cells (Dayton, Ohio), 31(11), 2364-2373 (2013-08-14)
The recently established reprogramming of somatic cells into induced pluripotent stem cells (iPSCs) by Takahashi and Yamanaka represents a valuable tool for future therapeutic applications. To date, the mechanisms underlying this process are still largely unknown. In particular, the mechanisms
C J Powers et al.
Endocrine-related cancer, 7(3), 165-197 (2000-10-06)
Fibroblast growth factors (FGFs) are small polypeptide growth factors, all of whom share in common certain structural characteristics, and most of whom bind heparin avidly. Many FGFs contain signal peptides for secretion and are secreted into the extracellular environment, where
A M Moon et al.
Development (Cambridge, England), 127(5), 989-996 (2000-02-09)
Fibroblast growth factors (FGFs) mediate multiple developmental signals in vertebrates. Several of these factors are expressed in limb bud structures that direct patterning of the limb. FGF4 is produced in the apical ectodermal ridge (AER) where it is hypothesized to

Articles

Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service