Skip to Content
Merck
All Photos(2)

Key Documents

AV49411

Sigma-Aldrich

Anti-HLA-F antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CDA12, Anti-HLA-5.4, Anti-HLA-CDA12, Anti-HLAF, Anti-Major histocompatibility complex, class I, F

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
RM 2,809.00

RM 2,809.00


Estimated to ship on28 April 2025



Select a Size

Change View
100 μL
RM 2,809.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

RM 2,809.00


Estimated to ship on28 April 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

48 kDa

species reactivity

pig, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... HLA-F(3134)

Related Categories

Immunogen

Synthetic peptide directed towards the N terminal region of human HLA-F

Application

Anti-HLA-F antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Major histocompatibility complex, class I, F (HLA-F) is a non-classic heavy chain that forms a heterodimer with β-2 microglobulin and participates in MHC-I antigen cross-presentation pathway.[1] HLA-F functions as a ligand for Ig-like receptors on natural killer cells that regulate the inflammatory response.[2]

Sequence

Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jodie P Goodridge et al.
Journal of immunology (Baltimore, Md. : 1950), 191(7), 3553-3562 (2013-09-11)
Killer Ig-like receptors (KIRs) are innate immune receptors expressed by NK and T cells classically associated with the detection of missing self through loss of their respective MHC ligand. Some KIR specificities for allelic classical class I MHC (MHC-I) have
Jodie P Goodridge et al.
Journal of immunology (Baltimore, Md. : 1950), 191(4), 1567-1577 (2013-07-16)
Peptides that are presented by MHC class I (MHC-I) are processed from two potential sources, as follows: newly synthesized endogenous proteins for direct presentation on the surface of most nucleated cells and exogenous proteins for cross-presentation typically by professional APCs.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service