Skip to Content
Merck
All Photos(1)

Key Documents

AV36498

Sigma-Aldrich

Anti-DDX54 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, Anti-DP97, Anti-MGC2835

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
RM 2,107.00

RM 2,107.00


Check Cart for Availability


Select a Size

Change View
100 μL
RM 2,107.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

RM 2,107.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

97 kDa

species reactivity

bovine, dog, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DDX54(79039)

Immunogen

Synthetic peptide directed towards the C terminal region of human DDX54

Biochem/physiol Actions

DEAD (Asp-Glu-Ala-Asp) box helicase 54 (DDX54) is a member of putative ATP-dependent RNA helicases called the DEAD box proteins. It is involved in regulation of RNA secondary structure during translation initiation, nuclear and mitochondrial splicing and ribosome and spliceosome assembly. DDX54 binds to myelin basic protein (MBP) in the brain and is critical for myelination in the central nervous system. Also known as DP97, this protein acts as a co-regulator of the constitutive androstane receptor.

Sequence

Synthetic peptide located within the following region: GPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGEGGAFEQQAAG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Rui Zhan et al.
Journal of neuroscience research, 91(3), 335-348 (2012-12-15)
We recently reported that a new monoclonal antibody, 4F2, which labels oligodendroglial lineage cells, recognizes a DEAD-box RNA helicase Ddx54 and that Ddx54 binds to myelin basic protein (MBP) in brain and cultured oligodendrocytes. To elucidate the biological function of
Yuichiro Kanno et al.
Biochemical and biophysical research communications, 426(1), 38-42 (2012-08-23)
The constitutive androstane receptor (CAR) plays a key role in the expression of xenobiotic/steroid and drug metabolizing enzymes and their transporters. In this study, we demonstrated that DP97, a member of the DEAD box DNA/RNA helicase protein family, is a
Frances V Fuller-Pace
Nucleic acids research, 34(15), 4206-4215 (2006-08-29)
The DExD/H box family of proteins includes a large number of proteins that play important roles in RNA metabolism. Members of this family have been shown to act as RNA helicases or unwindases, using the energy from ATP hydrolysis to

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service