WH0157285M1

Monoclonal Anti-DKFZp761P0423 antibody produced in mouse

clone 5C6, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-hypothetical protein DKFZp761P0423
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5C6, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: XM_291277
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PRAGMIN(157285)

Descripción

General description

The gene encoding homolog of rat pragma of Rnd2 (SGK223) or PRAGMIN is located on human chromosome 8p23.1.

Immunogen

DKFZp761P0423 (XP_291277, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE

Biochem/physiol Actions

Homolog of rat pragma of Rnd2 (SGK223) or PRAGMIN binds to the C-terminal Src kinase (CSK) and prevents its movement from the cytoplasm to the cell membrane.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)