Saltar al contenido
Merck
Todas las fotos(6)

Documentos clave

WH0004435M1

Sigma-Aldrich

Monoclonal Anti-CITED1 antibody produced in mouse

clone 6G8, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1, Anti-MSG1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

6G8, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human, rat, mouse

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CITED1(4435)

Descripción general

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) is a non-DNA binding transcriptional co-activator. It has a smad-4 interacting domain (SID) and a conserved region 2 (CR2) domain. This gene codes for a 27 kDa protein that belongs to the CITED (CBP/p300-interacting transactivators with glutamic acid [E] and aspartic acid [D]-rich C-terminal domain) family of nuclear proteins. CITED1 is located on human chromosome Xq13.
This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. (provided by RefSeq)

Inmunógeno

CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Acciones bioquímicas o fisiológicas

CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) controls cellular activities of the metanephric mesenchyme. This gene is linked to papillary thyroid carcinoma. MSG1 is involved in pigmentation. It also participates in malignant transformation of pigment cells.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Wilms' tumorigenesis is altered by misexpression of the transcriptional co-activator, CITED1
Lovvorn HN 3rd, et al.
Journal of Pediatric Surgery, 42(3), 474-481 (2007)
Galectin-3, fibronectin-1, CITED-1, HBME1 and cytokeratin-19 immunohistochemistry is useful for the differential diagnosis of thyroid tumors
Prasad ML, et al.
Modern Pathology, 18(1), 48-57 (2005)
Aberrant expression of MSG1 transcriptional activator in human malignant melanoma in vivo
Ahmed NU, et al.
Pigment Cell Research / Sponsored by the European Society for Pigment Cell Research and the International Pigment Cell Society, 14(2), 140-143 (2001)
Establishment and genetic characterization of a novel mixed-phenotype acute leukemia cell line with EP300-ZNF384 fusion
Ping N, et al.
Journal of Hematology & Oncology, 8(1), 100-100 (2015)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico