WH0002515M1

Monoclonal Anti-ADAM2 antibody produced in mouse

clone 4A2, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-FTNB, Anti-PH30, Anti-PH30b, Anti-a disintegrin and metalloproteinase domain 2 (fertilin beta)
• MDL number: MFCD02262895
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4A2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_001464
• UniProt accession no.: Q99965
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ADAM2(2515)

Descripción

General description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. (provided by RefSeq)

Immunogen

ADAM2 (NP_001455, 376 a.a. ~ 475 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH

Biochem/physiol Actions

ADAM2 (disintegrin and metalloproteinase domain-containing protein 2) is an integrin binding protein. Absence of ADAM2 in mice causes defects in sperm-egg binding. In addition, it helps in transfer of sperm from the uterus into the oviduct.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)