The sequence for Product SRP0164, Histone H4 (2-58) human is as follows:SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGV
SRP0164
Histone H4 (2-58) human
recombinant, expressed in E. coli, ≥70% (SDS-PAGE)
Sinónimos:
HIST2H4A
Seleccione un Tamaño
Seleccione un Tamaño
About This Item
Productos recomendados
origen biológico
human
recombinante
expressed in E. coli
Ensayo
≥70% (SDS-PAGE)
Formulario
aqueous solution
mol peso
32 kDa
envase
pkg of 500 μg
condiciones de almacenamiento
avoid repeated freeze/thaw cycles
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
dry ice
temp. de almacenamiento
−70°C
Información sobre el gen
human ... HIST2H4A(8370)
Descripción general
Forma física
Nota de preparación
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
-
What is the amino acid sequence of Histone H4 (2-58) human, Product SRP0164?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico