SAB5200934

Monoclonal Anti-Sur2A - Apc antibody produced in mouse

clone S319A-14, purified immunoglobulin

• Sinónimos: Anti-ABC37, Anti-ABCC9, Anti-CMD10, Anti-Sulfonylurea receptor 2A
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: Allophycocyanin conjugate
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: S319A-14, monoclonal
• form: buffered aqueous solution
• mol wt: antigen predicted mol wt 120 kDa
• species reactivity: rat, mouse
• concentration: 1 mg/mL
• technique(s): immunocytochemistry: suitable; immunohistochemistry: suitable; western blot: suitable
• isotype: IgG2a
• NCBI accession no.: NP_001038185.1
• UniProt accession no.: P70170
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: mouse ... Abcc9(20928)

Descripción

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

PBS pH7.4, 50% glycerol, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable