We tested this antibody using 1 ug/ml and 2 ug/ml concentration in western blot and it did not work for protein extracted from human cells (HepG2), mouse cells (AML12) and male & female C57BL/6 mice liver. We used GAPDH as loading control and it worked perfectly, giving clear bands in those samples. However, no band was detected for USP30 using this antibody even at 2 ug/ml i.e 1:250 dilution of the antibody. This is a complete waste of money and the product should have been well validated before sale.
SAB2109073
Anti-USP30 antibody produced in rabbit
Anti-USP30 antibody produced in rabbit
1 of 1 reviewers received a sample product or took part in a promotion
affinity isolated antibody
Sinónimos:
FLJ40511, MGC10702
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.43
El producto SAB2109073 no se vende actualmente en su país Póngase en contacto con el Servicio técnico
Productos recomendados
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
57 kDa
reactividad de especies (predicha por homología)
canine, rabbit, horse, human, bovine, rat, guinea pig, mouse
concentración
0.5 mg/mL
técnicas
western blot: 1 μg/mL
Nº de acceso NCBI
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... USP30(57396)
Descripción general
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
Inmunógeno
Synthetic peptide directed towards the middle region of human USP30
Secuencia
Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
Forma física
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
nwg
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.
Si necesita más asistencia, póngase en contacto con Atención al cliente
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
