Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2108568

Sigma-Aldrich

Anti-FAM107A

IgG fraction of antiserum

Sinónimos:

Anti- FLJ30158, Anti- FLJ45473, Anti- TU3A, Anti-DRR1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

17 kDa

reactividad de especies

guinea pig, bovine, human, mouse, dog, rat

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable

nº de acceso

NM_007177

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FAM107A(11170)

Descripción general

FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It has a nuclear localization signal (NLS) and a coiled domain. FAM107A has 144 amino acids and is located on human chromosome 3p14.3.

Inmunógeno

Synthetic peptide directed towards the middle region of human FAM107A

Aplicación

Anti-FAM107A has been used in the quantification of DRR1 protein levels.

Acciones bioquímicas o fisiológicas

FAM107A (family with sequence similarity 107 member A) participates in neuronal cell survival. Overexpression of FAM107A has the ability to repress the development of tumor cells. It plays a major role in the progression of the embryo. FAM107A participates in cell invasion. This protein modulates FA dynamics and cell movement.
When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.

Secuencia

Synthetic peptide located within the following region: RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

FAM107A (family with sequence similarity 107, member A)
Kadomatsu K and Mu P
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Tanja Jene et al.
Psychoneuroendocrinology, 91, 149-158 (2018-03-21)
Understanding the neurobiological mechanisms underlying the response to an acute stressor may provide novel insights into successful stress-coping strategies. Acute behavioral stress-effects may be restricted to a specific time window early after stress-induction. However, existing behavioral test batteries typically span

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico