SAB2102838

Anti-ZNF263 (ab2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FPM315, Anti-ZKSCAN12, Anti-Zinc finger protein 263
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 77 kDa
• species reactivity: horse, bovine, dog, human, rabbit, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: O14978
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZNF263(10127)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human ZNF263

Biochem/physiol Actions

ZNF263 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers, 1 KRAB domain and 1 SCAN box domain. ZNF263 might play an important role in basic cellular processes as a transcriptional repressor.

Sequence

Synthetic peptide located within the following region: CHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable