SAB1413292

Monoclonal Anti-CLDN6 antibody produced in mouse

clone 1P8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: CLDN6
• UNSPSC Code: 51111800

Propiedades

• conjugate: unconjugated
• Quality Level: 100
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1P8, monoclonal
• form: buffered aqueous solution
• mol wt: 23.3 kDa
• species reactivity: human
• concentration: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• technique(s): ELISA: suitable
• isotype: IgG2b, kappa
• Protein ID accession no.: NM_021195.3
• shipped in: dry ice
• storage temp.: -10 to -25°C
• target post-translational modification: unmodified
• Gene Information: human ... CLDN6(9074)

Descripción

General description

Mouse monoclonal antibody raised against a full-length recombinant CLDN6.

Immunogen

CLDN6 (NP_067018.1, 1 a.a. ~ 220 a.a) full-length recombinant protein with GST tag.

Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAVIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Physical form

Solution in phosphate buffered saline, pH 7.4

Preparation Note

Purification by Protein A sepharose

Storage and Stability

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable