Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB1412123

Sigma-Aldrich

ANTI-CA1 antibody produced in mouse

clone 1E11, purified immunoglobulin, buffered aqueous solution

Sinónimos:

CA1, Car1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto SAB1412123 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

1E11, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen 54.45 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG1κ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CA1(759)

Descripción general

Carbonic anhydrase 1 (CA1) is a cytosolic protein, encoded by the gene mapped to human chromosome 8q21.2.[64} The encoded protein belongs to the carbonic anhydrase (CA) family. CA1 is highly expressed in blood. Its expression is also found in spinal cord motor neurons, intestinal, vascular, corneal epithelia, synovium and cardiac capillary endothelial cells.
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature. (provided by RefSeq)

Inmunógeno

CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

Acciones bioquímicas o fisiológicas

Carbonic anhydrase 1 (CA1) catalyzes the reversible hydration and dehydration reactions of CO2/ carbonic acid (H2CO3).[65} It plays a vital role in the transport of metal ions. In addition, it might also be involved in biomineralization and new bone formation. CA1 acts as an oncogene and leads to irregular cell calcification, apoptosis and migration in breast tumor tissues. Overexpression of the gene has been observed in serum of stage I non-small cell lung cancer (NSCLC) patients. It can be used as a potential biomarker for early diagnosis of NSCLC. Additionally, CA1 is also upregulated in amyotrophic lateral sclerosis (ALS) and is involved in motor neuron degeneration.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Dong-Bin Wang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 37(1), 553-559 (2015-08-02)
This study aimed to identify candidate biomarkers associated with stage I non-small cell lung cancer (NSCLC). Sera from three groups, a lung cancer group (n = 11), benign control group (n = 12), and normal control group (n = 10), were collected and pooled. Protein expression
Yabing Zheng et al.
BMC cancer, 15, 679-679 (2015-10-16)
Although mammary microcalcification is frequently observed and has been associated with poor survival in patients with breast cancer, the genesis of calcification remains unclear. Carbonic anhydrase I (CA1) has been shown to promote calcification by catalysing the hydration of CO2.
KeQiu Li et al.
Ecotoxicology and environmental safety, 105, 51-58 (2014-05-03)
Electronic waste (e-waste) disposal is a growing problem in China, and its effects on human health are a concern. To determine the concentrations of pollutants in peripheral blood and genetic aberrations near an e-waste disposal area in Jinghai, China, blood
Xiaochen Liu et al.
International journal of molecular sciences, 17(11) (2016-11-04)
Carbonic anhydrase I (CA1) is the cytosolic isoform of mammalian α-CA family members which are responsible for maintaining pH homeostasis in the physiology and pathology of organisms. A subset of CA isoforms are known to be expressed and function in

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico