Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB1411223

Sigma-Aldrich

Anti-SALL2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinónimos:

FLJ10414, FLJ55746, HSAL2, KIAA0360, ZNF795, p150(Sal2)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto SAB1411223 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

antigen 20.9 kDa

reactividad de especies

human

técnicas

western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SALL2(6297)

Descripción general

SALL2 is a multi-zinc finger transcription factor belonging to the Drosophila homeotic spalt-like family of developmental transcription factor genes. It is expressed during the development of human retina at the time of optic fissure closure.

Inmunógeno

SALL2 (ENSP00000320536, 1 a.a. ~ 198 a.a) full-length human protein.

Sequence
MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHLHYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA

Acciones bioquímicas o fisiológicas

SALL2 mainly associated with the growth arrest and pro-apoptotic functions. It is involved in eye morphogenesis. Alteration in the gene function causes ocular coloboma in humans and mice. It has ability to supress the c-MYC transcription by binding to the nuclease hypersensitive element of the c-MYC promoter.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Chang Kyoo Sung et al.
PloS one, 7(9), e46486-e46486 (2012-10-03)
p150, product of the SALL2 gene, is a binding partner of the polyoma virus large T antigen and a putative tumor suppressor. p150 binds to the nuclease hypersensitive element of the c-MYC promoter and represses c-MYC transcription. Overexpression of p150
Daniel Kelberman et al.
Human molecular genetics, 23(10), 2511-2526 (2014-01-15)
Ocular coloboma is a congenital defect resulting from failure of normal closure of the optic fissure during embryonic eye development. This birth defect causes childhood blindness worldwide, yet the genetic etiology is poorly understood. Here, we identified a novel homozygous
Hongcang Gu et al.
Biochimica et biophysica acta, 1809(4-6), 276-283 (2011-03-03)
The product of the SALL2 protein p150(Sal2) is a multi-zinc finger transcription factor with growth arrest and proapoptotic functions that overlap those of p53. Its DNA-binding properties are unknown. We have used a modified SELEX procedure with purified p150(Sal2) and

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico