Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB1409921

Sigma-Aldrich

Anti-LY6D antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Sinónimos:

E48

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto SAB1409921 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

antigen 13.3 kDa

reactividad de especies

human

técnicas

western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... LY6D(8581)

Descripción general

The gene LY6D (lymphocyte antigen 6 complex, locus D) is mapped to human chromosome 8q24.3. It belongs to the LY6 (lymphocyte antigen 6) gene family. The encoded protein is a membrane protein with molecular weight of 14kDa. It is a glycosyl phosphatidylinositol (GPI)-anchored protein.

Inmunógeno

LY6D (NP_003686.1, 1 a.a. ~ 128 a.a) full-length human protein.

Sequence
MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

Acciones bioquímicas o fisiológicas

LY6D (lymphocyte antigen 6 complex, locus D) is required for discriminating B lineage restricted common lymphoid progenitors. It is upregulated by X-ray irradiation-mediated DNA damage pathway controlled via ATM (ataxia telangiectasia mutated), CHK2 (checkpoint kinase 2) and p53. LY6D is upregulated in various cancers and is associated with patient survival outcome.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jie Hu et al.
American journal of medical genetics. Part A, 167A(8), 1921-1926 (2015-04-14)
A 7-year-old female with developmental delay (DD), autism spectrum disorder (ASD), intellectual disability (ID), attention deficit hyperactivity disorder (ADHD), and seizures was referred to our laboratory for oligomicroarray analysis. The analysis revealed a 540 kb microdeletion in the chromosome 8q24.3 region
Qingzhao Zhang et al.
PloS one, 8(8), e72397-e72397 (2013-09-12)
Common lymphoid progenitors (CLPs) are thought to represent major intermediates in the transition of hematopoietic stem cells (HSCs) to B lineage lymphocytes. However, it has been obvious for some time that CLPs are heterogeneous, and there has been controversy concerning
Linlin Luo et al.
Oncotarget, 7(10), 11165-11193 (2016-02-11)
Stem cell antigen-1 (Sca-1) is used to isolate and characterize tumor initiating cell populations from tumors of various murine models [1]. Sca-1 induced disruption of TGF-β signaling is required in vivo tumorigenesis in breast cancer models [2, 3-5]. The role
Maiko Kurosawa et al.
The FEBS journal, 279(24), 4479-4491 (2012-10-19)
In order to identify membrane proteins whose expression is induced by X-ray irradiation, we developed an antibody (Ab)-directed strategy using a phage Ab library. X-Ray-irradiated cells were screened with a phage Ab library in the presence of a large excess

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico