SAB1409329

Monoclonal Anti-MSI1 antibody produced in mouse

clone 4C7, purified immunoglobulin, buffered aqueous solution

• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4C7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 34.87 kDa
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_002442
• UniProt accession no.: O43347
• shipped in: dry ice
• Storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MSI1(4440)

Descripción

General description

This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13. (provided by RefSeq)

Immunogen

MSI1 (NP_002433, 190 a.a. ~ 273 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPM

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable