Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB1407792

Sigma-Aldrich

Anti-PDP2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Sinónimos:

KIAA1348

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

antigen ~60 kDa

reactividad de especies

human

técnicas

western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... PDP2(57546)

Descripción general

Mouse polyclonal antibody raised against a full-length human PDP2 protein.
PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is a mitochondrial serine phos­phatase consisting of a catalytic subunit (PDP2c). It is a Mg2+ dependent enzyme. It has two active isoforms PDP 1 and 2. It is expressed in mammalian mitochondria.

Inmunógeno

PDP2 (NP_065837.1, 1 a.a. ~ 529 a.a) full-length human protein.

Sequence
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG

Aplicación

Anti-PDP2 antibody produced in mouse is suitable for western blot analysis.

Acciones bioquímicas o fisiológicas

PDP2 (Pyruvate dehyrogenase phosphatase catalytic subunit 2) is indirectly associated with glycolysis and the tricarboxylic acid cycle and fatty acid (FA) synthesis. It is an Mg2+ dependent enzyme. PDP2 is mainly involved in the activation of phosphorylated pyruvate dehydrogenase complex (PDC), which is an essential component for the stimulation of the oxidative decarboxylation of pyruvate.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Junko Kato et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 66(Pt 3), 342-345 (2010-03-09)
Pyruvate dehydrogenase phosphatase (PDP) is a mitochondrial serine phosphatase that activates phosphorylated pyruvate dehydrogenase complex by dephosphorylation. In humans, two PDP isoforms (1 and 2) have been identified. PDP1 is composed of a catalytic subunit (PDP1c) and a regulatory subunit
Mary C Sugden et al.
American journal of physiology. Endocrinology and metabolism, 284(5), E855-E862 (2003-04-05)
The mitochondrial pyruvate dehydrogenase complex (PDC) catalyzes the oxidative decarboxylation of pyruvate, linking glycolysis to the tricarboxylic acid cycle and fatty acid (FA) synthesis. Knowledge of the mechanisms that regulate PDC activity is important, because PDC inactivation is crucial for

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico