SAB1403333

Monoclonal Anti-TNRC6C antibody produced in mouse

clone 3G11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ20015, KIAA1582
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3G11, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~36.89 kDa
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; indirect ELISA: suitable
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_018996
• Nº de acceso UniProt: Q9HCJ0
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... TNRC6C(57690)

Descripción

Descripción general

Mouse monoclonal antibody raised against a partial recombinant TNRC6C.

TNRC6C (Trinucleotide repeat containing 6C) is a member of GW182 (Gly-Trp) family consisting of a domain similar to Drosophila GW182 (also known as Gawky), a domain rich in GW or WG repeats followed by a glutamine (Q)-rich region at the N-proximal end, a central ubiquitin-associated (UBA) domain and an RNA-binding domain termed as RRM.

Inmunógeno

TNRC6C (NP_061869, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TDGPNNTNPMNSSPNPINAMQTNGLPNWGMAVGMGAIIPPHLQGLPGANGSSVSQVSGGSAEGISNSVWGLSPGNPATGNSNSGFSQGNGDTVNSALSAK

Aplicación

Monoclonal Anti-TNRC6C antibody produced mouse is suitable for indirect ELISA.

Acciones bioquímicas o fisiológicas

TNRC6C (Trinucleotide repeat containing 6C) plays an important role in the microRNA repression during protein synthesis via miRNA pathway. The C-terminal RRM RNA-binding domain mediates the process of translational repression. Its GW-rich and Q-rich domain also suppress the expression for protein synthesis by binding to a reporter mRNA. In addition to translational repression, the members of the GW182 family, also participate in the deadenylation and decay of miRNA by interacting with argonaute proteins.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable