SAB1403213

Monoclonal Anti-UCRC antibody produced in mouse

clone 2B5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: HSPC051, HSPC119, HSPC151
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2B5, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~33.04 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable
• isotipo: IgG2bκ
• Nº de acceso NCBI: BC005402
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... UCRC(29796)

Descripción

Descripción general

UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM

Inmunógeno

UCRC (AAH05402, 1 a.a. ~ 63 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable