Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB1403056

Sigma-Aldrich

Monoclonal Anti-FLOT1 antibody produced in mouse

clone 4A1, ascites fluid

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto SAB1403056 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

ascites fluid

tipo de anticuerpo

primary antibodies

clon

4A1, monoclonal

mol peso

antigen ~37.11 kDa

reactividad de especies

human

técnicas

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgMκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... FLOT1(10211)

Descripción general

Flotillin 1 (FLOT1) is an integral membrane protein and a component of lipid rafts. This estrogen responsive gene is localized on human chromosome 6p21.33.

Inmunógeno

FLOT1 (NP_005794.1, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDI

Acciones bioquímicas o fisiológicas

Flotillin 1 (FLOT1) has a role in endocytosis. It also functions in growth factor signaling and activates mitogen-activated protein kinase signaling. The protein has been associated with tumor progression and is expressed in many cancers.

Forma física

Clear solution

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

13 - Non Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade.
Winship AL
Cancer Investigation (2016)
Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-? signaling in nasopharyngeal carcinoma.
Cao S
Oncotarget (2016)
Integrative analysis for finding genes and networks involved in diabetes and other complex diseases
Regine Bergholdt
Genome Biology (2007)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico