SAB1402964

Monoclonal Anti-ZNF23 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: KOX16, MGC57283, ZNF359, ZNF612, Zfp612
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 2D3, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~37 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_145911
• Nº de acceso UniProt: P17027
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ZNF23(7571)

Descripción

Descripción general

The gene ZNF23 (zinc finger protein 23) is mapped to human chromosome 16q22, a region associated with frequent alterations in acute myeloid leukemia. It belongs to the family of KRAB–ZFPs (Krupple-associated box-containing zinc-finger proteins), a large family of transcription factors. These proteins contain a KRAB domain at the N-terminal. The C-terminal consists of 16 tandem C₂H₂ class zinc fingers. The protein is ubiquitously expressed and the levels are greatly decreased or lost in cases of human cancer. The gene spans a length of 3271 nucleotides that encodes a protein of 643 amino acids.

Inmunógeno

ZNF23 (NP_666016.1, 41 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQP

Acciones bioquímicas o fisiológicas

The gene ZNF23 (zinc finger protein 23) encodes a nuclear protein that is involved in the inhibition of cell cycle progression. Ectopic expression of this protein is associated with increased p27kip-1 expression, growth inhibition and cell cycle arrest in G1 phase. The gene functions as a tumor suppressor, as its down regulation has been associated with carcinogenesis.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable