SAB1402593

Monoclonal Anti-PXK, (C-terminal) antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ20335, MONaKA
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D11, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC014479
• UniProt accession no.: Q7Z7A4
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PXK(54899)

Descripción

General description

PXK binds to the Na,K-ATPase beta-1 (ATP1B1; MIM 182330) and beta-3 (ATP1B3; MIM 601867) subunits and modulates both Na,K-ATPase enzymatic and ion pump activities (Mao et al., 2005 [PubMed 16135750]).[supplied by OMIM

Immunogen

PXK (AAH14479.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable