SAB1401412

Monoclonal Anti-MYST3 antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: KAT6A, MGC167033, MOZ, RUNXBP2, ZNF220
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4D8, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2bκ
• Nº de acceso NCBI: NM_006766
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... MYST3(7994)

Descripción

Descripción general

MOZ (monocytic leukemia zinc finger protein) is also known as lysine acetyltransferase 6 (KAT6A) and belongs to the MYST (MOZ, YBF2/SAS3, SAS2 and TIP60) family. The KAT6 gene is mapped to human chromosomes 8p11.21.{87] The structure of KAT6 is evolutionarily conserved in organisms ranging from yeast to mammals. The encoded protein contains a nuclear localization domain (including H15), a histone-acetyltransferase domain (HAT), an acidic glutamate/aspartate-rich region, a double-plant homeodomain finger that interacts with acetylated histone H3 tails (PHD 1 and 2) and a serine and methionine-rich region containing a transactivation domain. In humans, the gene is broadly expressed in different tissues, strongly in the brain and to a lesser extent in the heart.

Inmunógeno

MYST3 (NP_006757, 81 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK

Acciones bioquímicas o fisiológicas

KAT6A (lysine acetyltransferase 6A) is a histone acetyltransferase.{87] It is a transcriptional co-activator. It acetylates histone H3 at K14 and K9 and H4 at K5, K8, K12 and K16 in vitro. KAT6A is associated with the regulation of cell cycle and stem cell homeostasis. In acute myeloid leukemia, the involvement of KAT6A along with CREB binding protein has been observed. KAT6A acts as an oncogene. Mutations and abnormal regulation in KAT6 gene is associated with solid tumors and developmental disorders in human. It serves as a key epigenetic regulator of hematopoiesis. Mutations in the gene lead to abnormal acetylation of K9 and K18 of histone3 as well as changes in the P53 signaling. Therefore, affecting multiple cellular processes and controlling disease conditions.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable