Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB1401263

Sigma-Aldrich

Monoclonal Anti-NFIX antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

Sinónimos:

NF1A

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
El producto SAB1401263 no se vende actualmente en su país Póngase en contacto con el Servicio técnico

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3D2, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... NFIX(4784)

Descripción general

Nuclear factor I X (NFIX) is encoded by the gene mapped to human chromosome 19p13.13. The encoded protein is a member of the nuclear factor one (NFI) family of transcription factors.

Inmunógeno

NFIX (NP_002492.2, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR

Aplicación

Monoclonal Anti-NFIX antibody produced in mouse has been used in chromatin immunoprecipitation (ChIP) and immunofluorescence (IF).

Acciones bioquímicas o fisiológicas

Nuclear factor I X (NFIX) plays a vital role in normal brain and skeletal development. The encoded protein regulates c-Mpl (thrombopoietin receptor) transcription and promote survival of hematopoietic stem and progenitor cells (HSPCs). Mutation in the gene has been observed in Sotos-like features and Marshall–Smith syndrome patients.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nfix Promotes Survival of Immature Hematopoietic Cells via Regulation of c-Mpl.
Hall T, et al.
Stem Cells (2018)
A novel microdeletion/microduplication syndrome of 19p13. 13.
Dolan M, et al.
Genetics in Medicine : Official Journal of the American College of Medical Genetics, 12(8), 503-503 (2010)
Array?CGH detection of a de novo 0.7?Mb deletion in 19p13.13 including CACNA1A associated with mental retardation and epilepsy with infantile spasms
Auvin S, et al.
Epilepsia, 50(11), 2501-2503 (2009)
Diana Vidovic et al.
Neural development, 13(1), 2-2 (2018-02-18)
Radial glial stem cells within the developing nervous system generate a variety of post-mitotic cells, including neurons and glial cells, as well as the specialised multi-ciliated cells that line the walls of the ventricular system, the ependymal cells. Ependymal cells
Transcriptional regulation of ependymal cell maturation within the postnatal brain
Vidovic D, et al.
Neural Dev., 13(1), 2-2 (2018)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico