QPREST27836
SILu™PrEST ZCPW2
SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution
About This Item
recombinante
expressed in E. coli LysA ArgA BL21(DE3)
Ensayo
>80% (SDS-PAGE)
Formulario
buffered aqueous solution
mol peso
predicted mol wt 26kDa including tags
purificado por
immobilized metal affinity chromatography (IMAC)
envase
pkg of 1nmol × 5 vials
condiciones de almacenamiento
avoid repeated freeze/thaw cycles
secuencia del inmunógeno
TATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEIDALMSEF
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
Información sobre el gen
human ... ZCPW2(152098)
Descripción general
Aplicación
Forma física
Nota de preparación
Nota de análisis
The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.
The specific human protein sequence begins directly after ′VDKLAAA′.
Información legal
Código de clase de almacenamiento
12 - Non Combustible Liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documentos section.
Si necesita más asistencia, póngase en contacto con Atención al cliente
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico