MSST0060
SILu™Lite CST3, Cystatin C human
recombinant, expressed in E. coli, MS Protein Standard
Sinónimos:
CST3, Cystatin C
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
50 μG
MXP 17,019.00
MXP 17,019.00
Check Cart for Availability
Seleccione un Tamaño
Cambiar Vistas
50 μG
MXP 17,019.00
About This Item
Código UNSPSC:
23201100
NACRES:
NA.32
MXP 17,019.00
Check Cart for Availability
Productos recomendados
recombinante
expressed in E. coli
Nivel de calidad
Ensayo
≥95% (SDS-PAGE)
Formulario
lyophilized powder
idoneidad
suitable for mass spectrometry (internal calibrator)
Nº de acceso UniProt
Condiciones de envío
ambient
temp. de almacenamiento
−20°C
Información sobre el gen
human ... CST3(1471)
Categorías relacionadas
Descripción general
SILu™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Acciones bioquímicas o fisiológicas
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Secuencia
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Forma física
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Información legal
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
