Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

HPA045511

Sigma-Aldrich

Anti-MICU2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-EF-Hand Domain Family, Member A1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 12,107.00

MXP 12,107.00


Check Cart for Availability


Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 12,107.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

MXP 12,107.00


Check Cart for Availability

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:20- 1:50

secuencia del inmunógeno

LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... EFHA1(221154)

Categorías relacionadas

Descripción general

MICU2 (mitochondrial calcium uptake 2) belongs to the uniporter complex. It is vigorously expressed in visceral organs. It is usually seen in the mitochondrial intermembrane space. It is located on chromosome 13q11-q12.

Inmunógeno

EF-hand domain family, member A1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-MICU2 has been used in western blotting.[1]

Acciones bioquímicas o fisiológicas

MICU2 (mitochondrial calcium uptake 2) plays an important role in the modulation of the mitochondrial calcium uniporter.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST81358

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Whole Genome Sequencing identifies homozygous BRCA2 deletion guiding treatment in de-differentiated prostate cancer.
Purshouse K, et al.
Cold Spring Harbor molecular case studies (2017)
MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
Plovanich M, et al.
PLoS ONE, 8(2):e55785 (2013)
Critical reappraisal confirms that Mitofusin 2 is an endoplasmic reticulum?mitochondria tether.
Naon D, et al.
Proceedings of the National Academy of Sciences of the USA, 113(40), 11249-11254 (2016)
Santhanam Shanmughapriya et al.
Nature communications, 9(1), 3449-3449 (2018-08-31)
Although many factors contribute to cellular differentiation, the role of mitochondria Ca2+ dynamics during development remains unexplored. Because mammalian embryonic epiblasts reside in a hypoxic environment, we intended to understand whether mCa2+ and its transport machineries are regulated during hypoxia.
Julian D C Serna et al.
American journal of physiology. Renal physiology, 323(1), F92-F106 (2022-05-03)
Caloric restriction (CR) prevents obesity and increases resilience against pathological stimuli in laboratory rodents. At the mitochondrial level, protection promoted by CR in the brain and liver is related to higher Ca2+ uptake rates and capacities, avoiding Ca2+-induced mitochondrial permeability

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico