Saltar al contenido
Merck
Todas las fotos(2)

Documentos

HPA039357

Sigma-Aldrich

Anti-WDR73 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-FLJ14888, Anti-HSPC264, Anti-WD repeat domain 73

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WDR73(84942)

Categorías relacionadas

General description

WD repeat domain 73 (WDR73) belongs to WD repeat domain family of proteins. The motif contains 40-60 amino acids with tryptophan (W) and aspartate (D). WDR73 gene is widely expressed in kidney and brain and is located on human chromosome 15q25.2.

Immunogen

WD repeat domain 73 recombinant protein epitope signature tag (PrEST)

Application

Anti-WDR73 antibody produced in rabbit has been used in immunofluorescence microscopy to confirm role of truncated WDR73 in the nephrocerebellar syndrome .
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem/physiol Actions

WDR73 plays a key role in the microtubule organization and in the regulation of mitosis and cell proliferation. WDR73 interacts with proteins associated with cell cycle and cell survival. A WDR73 gene mutation leads to Galloway-Mowat syndrome, a rare genetic disorder majorly affecting brain and kidney functions. The truncated WDR73 protein brings poor brain differentiation and this trait is genetically inherited . Mutations are also associated with neurodegeneration in infants, in particular with the cerebellum of the brain.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST81550

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Loss-of-function mutations in WDR73 are responsible for microcephaly and steroid-resistant nephrotic syndrome: Galloway-Mowat syndrome
Colin E, et al.
American Journal of Human Genetics, 95(6), 637-648 (2014)
Recessive nephrocerebellar syndrome on the Galloway-Mowat syndrome spectrum is caused by homozygous protein-truncating mutations of WDR73
Jinks RN, et al.
Brain, 138(8), 2173-2190 (2015)
WDR73 mutations cause infantile neurodegeneration and variable glomerular kidney disease
Vodopiutz J, et al.
Human Mutation, 36(11), 1021-1028 (2015)
Nonsense mutation in the WDR73 gene is associated with Galloway-Mowat syndrome
Ben-Omran T, et al.
Journal of medical Genetics, 52(6), 381-390 (2015)
F C Tilley et al.
Scientific reports, 11(1), 5388-5388 (2021-03-10)
Several studies have reported WDR73 mutations to be causative of Galloway-Mowat syndrome, a rare disorder characterised by the association of neurological defects and renal-glomerular disease. In this study, we demonstrate interaction of WDR73 with the INTS9 and INTS11 components of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico