HPA035526
Anti-FYCO1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-FLJ13335, Anti-FYVE and coiled-coil domain containing 1, Anti-ZFYVE7
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
Atlas de proteínas humanas número:
Productos recomendados
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
Formulario
buffered aqueous glycerol solution
reactividad de especies
human
técnicas
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
secuencia del inmunógeno
IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... FYCO1(79443)
Descripción general
FYVE and coiled-coil domain containing 1 (FYCO1) codes for a protein with 1478 amino acids. It has 18 exons and is of 79 kb in length. FYCO1 has a long central coiled-coil region flanked at the N terminus by an α-helical RUN domain or a zinc finger domain and at the C terminus by a FYVE domain. It is abundantly expressed in heart and skeletal muscle, skin, adipose tissue and the ovary. FYCO1 is a member of the emerging group of autophagic adaptor proteins. FYCO1 is located on human chromosome 3p21.31.
Inmunógeno
FYVE and coiled-coil domain containing 1 recombinant protein epitope signature tag (PrEST)
Aplicación
Anti-FYCO1 antibody has been used in immunostaining.
Acciones bioquímicas o fisiológicas
FYVE and coiled-coil domain containing 1 (FYCO1) helps in the movement of autophagosomes along microtubules through its association with LC3. Mutations in FYCO1 results in autosomal-recessive congenital cataracts. FYCO1 participates in the progression of lens and transparency in humans.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST79454
Forma física
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Mutations in FYCO1 cause autosomal-recessive congenital cataracts.
Chen J, et al.
American Journal of Human Genetics, 88(6), 827-838 (2011)
Proteomics of rimmed vacuoles define new risk allele in inclusion body myositis.
Guttsches AK, et al.
Annals of Neurology, 81(2), 227-239 (2017)
Repeated ER?endosome contacts promote endosome translocation and neurite outgrowth.
Raiborg C, et al.
Nature, 520(7546), 234-234 (2015)
Hallvard L Olsvik et al.
The Journal of biological chemistry, 290(49), 29361-29374 (2015-10-16)
FYCO1 (FYVE and coiled-coil protein 1) is a transport adaptor that binds to phosphatidylinositol 3-phosphate, to Rab7, and to LC3 (microtubule-associated protein 1 light chain 3) to mediate transport of late endosomes and autophagosomes along microtubules in the plus end
Marlena Rohm et al.
Cells, 12(12) (2023-06-28)
Pompe disease is a rare genetic metabolic disorder caused by mutations in acid-alpha glucoside (GAA) leading to pathological lysosomal glycogen accumulation associated with skeletal muscle weakness, respiratory difficulties and cardiomyopathy, dependent from the GAA residual enzyme activity. This study aimed
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico