Saltar al contenido
Merck
Todas las fotos(6)

Documentos clave

HPA028897

Sigma-Aldrich

Anti-SMAD7 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-MADH7, Anti-MADH8, Anti-SMAD family member 7

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 11,020.00

MXP 11,020.00


Check Cart for Availability


Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 11,020.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

MXP 11,020.00


Check Cart for Availability

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

secuencia del inmunógeno

EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SMAD7(4092)

¿Está buscando productos similares? Visita Guía de comparación de productos

Descripción general

SMAD7 (mothers against decapentaplegic homolog 7) is a Tbx1 (T-box 1) interacting gene. It is an inhibitor of the TGFβ (transforming growth factor β) /BMP (bone morphogenetic proteins) pathway. It is located on chromosome 18q21.1.

Inmunógeno

SMAD family member 7 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SMAD7 has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

SMAD7 (mothers against decapentaplegic homolog 7) is a modulator of TGFβ(transforming growth factor β) signaling in immune cells that are associated to ulcerative colitis and inflammatory bowel syndrome. It plays a major role in the etiology of CRC (colorectal cancer). It even functions as a mediator of the negative feedback loop for both the TGFβ and BMP (bone morphogenetic proteins) signaling pathways. It is essential for the remodelling of pharyngeal artery and the enlargement of great vessel. In mouse, homozygous removal of Smad7 causes primarily fourth-related arch artery defects. Silencing of Smad7 in RCD (refractory coeliac disease) biopsy samples can decrease the expression of interleukin-6 and tumour necrosis factor-α. Polymorphism of this gene is associated with colorectal cancer.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86713

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Tbx1 genetically interacts with the transforming growth factor-?/bone morphogenetic protein inhibitor Smad7 during great vessel remodeling
Papangeli I and Scambler PJ
Circulation Research, 112(1), 90-102 (2013)
Intronic polymorphisms of the SMAD7 gene in association with colorectal cancer
Damavand B, et al.
Asian Pacific Journal of Cancer Prevention, 16(1), 41-44 (2015)
Vjera Mihaljević et al.
Biomedicines, 10(11) (2022-11-27)
Aims: Chronic diabetes complications, including diabetic nephropathy (DN), frequently result in end-stage renal failure. This study investigated empagliflozin (SGLT2i) effects on collagen synthesis, oxidative stress, cell survival, and protein expression in an LLC-PK1 model of DN. Methods: Combinations of high
High Smad7 sustains inflammatory cytokine response in refractory coeliac disease
Sedda S, et al.
Immunology, 150(3), 356-363 (2017)
Multiple functional risk variants in a SMAD7 enhancer implicate a colorectal cancer risk haplotype
Fortini BK, et al.
PLoS ONE, 9(11) (2014)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico