HPA026830

Anti-PHF13 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-PHD finger protein 13
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA026830
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• secuencia del inmunógeno: GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT
• Nº de acceso UniProt: Q86YI8
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PHF13(148479)

Descripción

Descripción general

The gene PHD finger protein 13 (PHF13), also known as survival time associated PHD finger protein in Ovarian Cancer 1 (SPOC1), is mapped to human chromosome 1p36.3, a region associated with chromosomal instability and tumor development.s The gene codes for a 34kDa nuclear protein containing 300 amino acids. The protein is characterized with a C-terminal single PHD (plant homeodomain) involved in chromatin specific interactions and a bipartite nuclear localization sequence. PHF13 mRNA is ubiquitously expressed at a low level in all tissues and it is expressed at high level in the testis and ovaries.

Inmunógeno

PHD finger protein 13 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

PHD finger protein 13 (PHF13) or survival time associated PHD finger protein in ovarian cancer 1 (SPOC1) is a tightly regulated chromatin-associated protein, involved in chromatin structure modulation. The encoded protein helps in proper mitotic chromosome condensation and cell division. PHF13 /SPOC1 might have a role in cell proliferation and oncogenesis. SPOC1 is crucial for spermatogonial stem cell differentiation and spermatogenesis. Elevated expression of SPOC1 leads to unresectable carcinomas and decreased survival rates in ovarian cancer patients. SPOC1/ PHF13 plays a vital role in radiosensitivity and DNA damage repair with the help of chromatin modifiers and DDR (DNA damage response) regulators.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72593

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable