HPA026288

Anti-CSNK1E antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-CKI-epsilon, Anti-CKIe, Anti-Casein kinase I isoform epsilon
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA026288
• NACRES: NA.43

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL
• immunogen sequence: NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP
• UniProt accession no.: P49674
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CSNK1E(1454)

Descripción

General description

Casein kinase 1 ε (CSNK1E) is part of the serine/threonine protein kinase family. The gene encoding it is localized on human chromosome 22q13.1.

Immunogen

casein kinase 1 epsilon recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. These antibodies have also been used in immunofluorescence. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Casein kinase 1 ε (CSNK1E) phosphorylates proteins of the Wnt signaling cascade. It modulates tumor growth and cell division in salivary gland cancer, pancreatic and colon adenocarcinoma cells. CSNK1E phosphorylates dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32) and modulates dopamine receptor signaling. It also interacts with proteins involved in circadian rhythm.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77845

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable