Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

HPA023088

Sigma-Aldrich

Anti-SLIT2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Sinónimos:

Anti-Slit homolog 2 protein, Anti-Slit-2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
MXP 11,020.00

MXP 11,020.00


Check Cart for Availability


Seleccione un Tamaño

Cambiar Vistas
100 μL
MXP 11,020.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

MXP 11,020.00


Check Cart for Availability

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

LYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLIT2(9353)

Descripción general

SLIT2 (slit guidance ligand 2) is a secreted glycoprotein and associates with ROBO (roundabout) receptor.[1] SLIT2 mRNA is present in the brain, spinal cord, and thyroid. The gene is mapped to human chromosome 4p15. It is also referred to as SLIL3.

Inmunógeno

Slit homolog 2 protein Precursor recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-SLIT2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

The SLIT2 (slit guidance ligand 2)/ROBO (roundabout) complex is crucial for the axon guidance and neural crest cell migration. The complex also enhances intestinal tumorigenesis.[1] On the other hand, inactivation of SLIT2 is associated with the presence of dysplastic lesions of head and neck. Mutations in SLIT2 are linked with high risk of congenital anomalies of the kidney and urinary tract (CAKUT).

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST74497

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Dana M Brantley-Sieders et al.
Cancer research, 71(3), 976-987 (2010-12-15)
It is well known that tumor-derived proangiogenic factors induce neovascularization to facilitate tumor growth and malignant progression. However, the concept of "angiocrine" signaling, in which signals produced by endothelial cells elicit tumor cell responses distinct from vessel function, has been
J Yu et al.
Oncogene, 29(39), 5370-5380 (2010-07-14)
The neuronal repellent SLIT2 is repressed in a number of cancer types primarily through promoter hypermethylation. SLIT2, however, has not been studied in prostate cancer. Through genome-wide location analysis we identified SLIT2 as a target of polycomb group (PcG) protein
Guru Prasad Maiti et al.
Oral surgery, oral medicine, oral pathology and oral radiology, 119(2), 202-212 (2014-12-04)
The protein SLIT2 and its receptor ROBO1 regulate different cellular processes, such as proliferation, apoptosis, and migration. In this study our aim is to understand the alterations of these genes during development of head and neck squamous cell carcinoma (HNSCC).
Weibing Tang et al.
Journal of cellular and molecular medicine, 19(6), 1197-1207 (2015-03-20)
Hirschsprung's disease (HSCR) is a rare congenital disease caused by impaired proliferation and migration of neural crest cells. We investigated changes in expression of microRNAs (miRNAs) and the genes they regulate in tissues of patients with HSCR. Quantitative real-time PCR
Qian-Qian Zhang et al.
Oncotarget, 6(5), 3123-3135 (2015-01-22)
Slit2 is often overexpressed in cancers. Slit2 is a secreted protein that binds to Roundabout (Robo) receptors to regulate cell growth and migration. Here, we employed several complementary mouse models of intestinal cancers, including the Slit2 transgenic mice, the ApcMin/+

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico